Antimicrobial peptides from the skin of the Tsushima brown frog Rana tsushimensis
The Tsushima brown frog Rana tsushimensis Stejneger, 1907 exists in reproductive isolation on the island of Tsushima, Japan. Six peptides with antimicrobial activity were isolated in pure form from an extract of the skin of this species and their amino acid sequences identified them as members of th...
Gespeichert in:
| Veröffentlicht in: | Comparative biochemistry and physiology. Toxicology & pharmacology Jg. 143; H. 1; S. 42 - 49 |
|---|---|
| Hauptverfasser: | , , , , , , , , |
| Format: | Journal Article |
| Sprache: | Englisch |
| Veröffentlicht: |
United States
Elsevier Inc
01.05.2006
Elsevier |
| Schlagworte: | |
| ISSN: | 1532-0456, 1878-1659 |
| Online-Zugang: | Volltext |
| Tags: |
Tag hinzufügen
Keine Tags, Fügen Sie den ersten Tag hinzu!
|
| Zusammenfassung: | The Tsushima brown frog
Rana tsushimensis Stejneger, 1907 exists in reproductive isolation on the island of Tsushima, Japan. Six peptides with antimicrobial activity were isolated in pure form from an extract of the skin of this species and their amino acid sequences identified them as members of the brevinin-1 (one peptide), brevinin-2 (one peptide) and temporin (four peptides) families. The C-terminally α-amidated brevinin-1 peptide (FLGSIVGALASALPSLISKIRN.NH
2) lacks the cyclic heptapeptide domain Cys
18–(Xaa)
4–Lys–Cys
24 at the COOH-terminus of the molecule that characterizes other members of that family. A structurally similar brevinin-1 peptide, also lacking the cyclic domain, was previously isolated from the skin of the Ryukyu brown frog
Rana okinavana, indicative of a close phylogenetic relationship between the species. Brevinin-2TSa (GIMSLFKGVLKTAGKHVAGSLVDQLKCKITGGC) showed broad-spectrum growth inhibitory activity against a range of Gram-negative and Gram-positive bacteria (including methicillin-resistant
Staphylococcus aureus) (minimum inhibitory concentrations
≤
25 μM) and relatively low hemolytic activity against human erythrocytes (LD50
=
100 μM). The peptide therefore represents a candidate for drug development. |
|---|---|
| Bibliographie: | ObjectType-Article-1 SourceType-Scholarly Journals-1 ObjectType-Feature-2 content type line 23 |
| ISSN: | 1532-0456 1878-1659 |
| DOI: | 10.1016/j.cbpc.2005.11.022 |